![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
![]() | Protein automated matches [226946] (26 species) not a true protein |
![]() | Species Aeropyrum pernix [TaxId:56636] [255747] (2 PDB entries) |
![]() | Domain d3wxmg2: 3wxm G:228-322 [262488] Other proteins in same PDB: d3wxma1, d3wxma3, d3wxmc1, d3wxmc3, d3wxme1, d3wxme3, d3wxmg1, d3wxmg3 protein/RNA complex; complexed with gtp, mg |
PDB Entry: 3wxm (more details), 2.3 Å
SCOPe Domain Sequences for d3wxmg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wxmg2 b.43.3.0 (G:228-322) automated matches {Aeropyrum pernix [TaxId: 56636]} pvdkplripvqnvysipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlq qaepgdnigfavrgvsksdikrgdvaghldkpptv
Timeline for d3wxmg2: