Class b: All beta proteins [48724] (176 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
Protein automated matches [254425] (14 species) not a true protein |
Species Aeropyrum pernix [TaxId:56636] [255748] (1 PDB entry) |
Domain d3wxme3: 3wxm E:323-432 [262486] Other proteins in same PDB: d3wxma1, d3wxma2, d3wxmc1, d3wxmc2, d3wxme1, d3wxme2, d3wxmg1, d3wxmg2 protein/RNA complex; complexed with gtp, mg |
PDB Entry: 3wxm (more details), 2.3 Å
SCOPe Domain Sequences for d3wxme3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wxme3 b.44.1.0 (E:323-432) automated matches {Aeropyrum pernix [TaxId: 56636]} aeefearifviwhpsaitvgytpvihvhtasvssriieikakldpktgqvveqnpqflka gdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvgigivtdvkpakv
Timeline for d3wxme3: