Lineage for d3wwpb_ (3wwp B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1871035Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1871036Protein automated matches [190543] (71 species)
    not a true protein
  7. 1871102Species Baliospermum montanum [TaxId:316758] [260622] (2 PDB entries)
  8. 1871104Domain d3wwpb_: 3wwp B: [262477]
    automated match to d3wwpm_
    complexed with cit, cl, edo, so4

Details for d3wwpb_

PDB Entry: 3wwp (more details), 1.9 Å

PDB Description: S-selective hydroxynitrile lyase from Baliospermum montanum (apo2)
PDB Compounds: (B:) (S)-hydroxynitrile lyase

SCOPe Domain Sequences for d3wwpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wwpb_ c.69.1.0 (B:) automated matches {Baliospermum montanum [TaxId: 316758]}
gfmvsahfilihtichgawlwyklipllqsaghnataidlvasgidprqleqigtweqys
eplftliesipegkkvilvgesggginialaaekypekvsalvfhnalmpdidhspafvy
kkfsevftdwkdsifsnytygndtvtavelgdrtlaenifsnspiedvelakhlvrkgsf
feqdldtlpnftsegygsirrvyvygeedqifsrdfqlwqinnykpdkvycvpsadhkiq
iskvnelaqilqevansasdl

SCOPe Domain Coordinates for d3wwpb_:

Click to download the PDB-style file with coordinates for d3wwpb_.
(The format of our PDB-style files is described here.)

Timeline for d3wwpb_: