SCOPe 2.05: Domain d3wtyg_: 3wty G:

Lineage for d3wtyg_ (3wty G:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.54: Core binding factor beta, CBF [50722] (1 superfamily)
   barrel, closed; n=6, S=10; meander; capped at both ends by alpha-helices

4. Superfamily b.54.1: Core binding factor beta, CBF [50723] (1 family)
   automatically mapped to Pfam PF02312

5. Family b.54.1.1: Core binding factor beta, CBF [50724] (2 proteins)

6. Protein automated matches [259048] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [259049] (7 PDB entries)

8. Domain d3wtyg_: 3wty G: [262470]
   Other proteins in same PDB: d3wtya_, d3wtyc_, d3wtyf_
   automated match to d2jhba_
   protein/DNA complex

Details for d3wtyg_

PDB Entry: 3wty, 2.7 Å

PDB Description: crystal structure of the complex comprised of ets1(g333p), runx1, cbfbeta, and the tcralpha gene enhancer dna

PDB Compounds: (G:) Core-binding factor subunit beta

SCOPe Domain Sequences for d3wtyg_:

Sequence, based on SEQRES records:

>d3wtyg_ b.54.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvatg
tnlslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlhrldg
mgclefdeeraqqedala

Sequence, based on observed residues (ATOM records):

>d3wtyg_ b.54.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvatg
tnlslqffpapsreyvdlereagkvylkapmilngvcviwkgwidlhrldgmgclefdee
raqqedala

Timeline for d3wtyg_:

• d3wtyg_ is new in SCOPe 2.05-stable
  
• d3wtyg_ appears in SCOPe 2.06
  
• d3wtyg_ appears in the current release, SCOPe 2.08