| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
| Family b.2.5.6: RUNT domain [81318] (2 proteins) automatically mapped to Pfam PF00853 |
| Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species) synonym: core binding factor alpha, cbfa |
| Species Mouse (Mus musculus) [TaxId:10090] [63684] (14 PDB entries) almost identical sequence to the human protein |
| Domain d3wtuf_: 3wtu F: [262463] Other proteins in same PDB: d3wtub_, d3wtuc_, d3wtug_ automated match to d1hjbc_ protein/DNA complex |
PDB Entry: 3wtu (more details), 2.7 Å
SCOPe Domain Sequences for d3wtuf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wtuf_ b.2.5.6 (F:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Mouse (Mus musculus) [TaxId: 10090]}
gelvrtdspnflcsvlpthwrcnktlpiafkvvakgdvpdgtlvtvmagndenysaelrn
ataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitadgprepr
Timeline for d3wtuf_:
View in 3DDomains from other chains: (mouse over for more information) d3wtua_, d3wtub_, d3wtuc_, d3wtug_ |