Lineage for d3wtuc_ (3wtu C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1721885Family a.4.5.21: ets domain [46859] (9 proteins)
  6. 1721930Protein automated matches [191121] (2 species)
    not a true protein
  7. 1721931Species Human (Homo sapiens) [TaxId:9606] [193283] (12 PDB entries)
  8. 1721946Domain d3wtuc_: 3wtu C: [262462]
    Other proteins in same PDB: d3wtua_, d3wtub_, d3wtuf_, d3wtug_
    automated match to d1gvjb_
    protein/DNA complex

Details for d3wtuc_

PDB Entry: 3wtu (more details), 2.7 Å

PDB Description: crystal structure of the complex comprised of ets1 (v170a), runx1, cbfbeta, and the tcralpha gene enhancer dna
PDB Compounds: (C:) Protein C-ets-1

SCOPe Domain Sequences for d3wtuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wtuc_ a.4.5.21 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkr
knkpkmnyeklsrglryyydkniihktagkryvyrfvcdlqsllgytpeelhamldvk

SCOPe Domain Coordinates for d3wtuc_:

Click to download the PDB-style file with coordinates for d3wtuc_.
(The format of our PDB-style files is described here.)

Timeline for d3wtuc_: