SCOPe 2.05: Domain d3wswd1: 3wsw D:3-147

Lineage for d3wswd1 (3wsw D:3-147)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Enterococcus mundtii [TaxId:53346] [259610] (2 PDB entries)

8. Domain d3wswd1: 3wsw D:3-147 [262457]
   Other proteins in same PDB: d3wswa2, d3wswb2, d3wswc2, d3wswd2
   automated match to d3wsva1
   complexed with fbp, gol, nad

Details for d3wswd1

PDB Entry: 3wsw, 2.3 Å

PDB Description: crystal structure of minor l-lactate dehydrogenase from enterococcus mundtii in the ligands-bound form

PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3wswd1:

Sequence; same for both SEQRES and ATOM records:

>d3wswd1 c.2.1.0 (D:3-147) automated matches {Enterococcus mundtii [TaxId: 53346]}
ktsrkvvivgtgfvgtsiayaminqgvanelvlidvnqekaegealdlldgmawgeknvs
vwsgtyeecqdanlviltagvnqkpgqtrldlvktnatitrqivkevmasgfdgifvvas
npvdiltyltwqesglpasrvvgtg

Timeline for d3wswd1:

• d3wswd1 is new in SCOPe 2.05-stable
  
• d3wswd1 appears in SCOPe 2.06
  
• d3wswd1 appears in the current release, SCOPe 2.08