Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Enterococcus mundtii [TaxId:53346] [259610] (2 PDB entries) |
Domain d3wswd1: 3wsw D:3-147 [262457] Other proteins in same PDB: d3wswa2, d3wswb2, d3wswc2, d3wswd2 automated match to d3wsva1 complexed with fbp, gol, nad |
PDB Entry: 3wsw (more details), 2.3 Å
SCOPe Domain Sequences for d3wswd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wswd1 c.2.1.0 (D:3-147) automated matches {Enterococcus mundtii [TaxId: 53346]} ktsrkvvivgtgfvgtsiayaminqgvanelvlidvnqekaegealdlldgmawgeknvs vwsgtyeecqdanlviltagvnqkpgqtrldlvktnatitrqivkevmasgfdgifvvas npvdiltyltwqesglpasrvvgtg
Timeline for d3wswd1: