Lineage for d1qgfa_ (1qgf A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2404927Protein Elastase [50536] (4 species)
  7. 2404954Species Pig (Sus scrofa) [TaxId:9823] [50538] (123 PDB entries)
  8. 2405000Domain d1qgfa_: 1qgf A: [26245]
    complexed with ca, so4, tpx

Details for d1qgfa_

PDB Entry: 1qgf (more details), 1.7 Å

PDB Description: porcine pancreatic elastase complexed with (3r, 4s)n-para- toluenesulphonyl-3-ethyl-4-(carboxylic acid)pyrrolidin-2-one
PDB Compounds: (A:) elastase

SCOPe Domain Sequences for d1qgfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgfa_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOPe Domain Coordinates for d1qgfa_:

Click to download the PDB-style file with coordinates for d1qgfa_.
(The format of our PDB-style files is described here.)

Timeline for d1qgfa_: