Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins) |
Protein automated matches [190245] (11 species) not a true protein |
Species Camellia sinensis [TaxId:4442] [256516] (3 PDB entries) |
Domain d3wq4b_: 3wq4 B: [262443] automated match to d1cbga_ complexed with nag |
PDB Entry: 3wq4 (more details), 1.9 Å
SCOPe Domain Sequences for d3wq4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wq4b_ c.1.8.4 (B:) automated matches {Camellia sinensis [TaxId: 4442]} sfnrtsfpdgfvfgaassayqfegaakeggkgpniwdtfthefpgkisngstgdvaddfy hrykedvkvlkfigldgfrmsiswarvlprgklsggvnkegiafynnvindllskgiqpf itifhwdlpqaledeyggflsphivndfrdfaelcfkefgdrvkhwitmnepwsysyggy dagllapgrcsafmafcpkgnsgtepyivthnlllshaaavklykekyqayqkgqigitl vtywmipysnskadkdaaqraldfmygwfieplsfgeypksmrrlvgkrlprftkeqaml vkgsfdflglnyyianyvlnvptsnsvnlsyttdslsnqtafrngvaigrptgvpaffmy pkglkdllvytkekyndpviyitengmgdnnnvtteegikdpqrvyfynqhllslknaia agvkvkgyftwafldnfewlsgytqrfgivyvdfkdglkrypkhsalwfkkfll
Timeline for d3wq4b_: