Lineage for d3wq4b_ (3wq4 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083072Protein automated matches [190245] (11 species)
    not a true protein
  7. 2083076Species Camellia sinensis [TaxId:4442] [256516] (3 PDB entries)
  8. 2083082Domain d3wq4b_: 3wq4 B: [262443]
    automated match to d1cbga_
    complexed with nag

Details for d3wq4b_

PDB Entry: 3wq4 (more details), 1.9 Å

PDB Description: crystal structure of beta-primeverosidase
PDB Compounds: (B:) beta-primeverosidase

SCOPe Domain Sequences for d3wq4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wq4b_ c.1.8.4 (B:) automated matches {Camellia sinensis [TaxId: 4442]}
sfnrtsfpdgfvfgaassayqfegaakeggkgpniwdtfthefpgkisngstgdvaddfy
hrykedvkvlkfigldgfrmsiswarvlprgklsggvnkegiafynnvindllskgiqpf
itifhwdlpqaledeyggflsphivndfrdfaelcfkefgdrvkhwitmnepwsysyggy
dagllapgrcsafmafcpkgnsgtepyivthnlllshaaavklykekyqayqkgqigitl
vtywmipysnskadkdaaqraldfmygwfieplsfgeypksmrrlvgkrlprftkeqaml
vkgsfdflglnyyianyvlnvptsnsvnlsyttdslsnqtafrngvaigrptgvpaffmy
pkglkdllvytkekyndpviyitengmgdnnnvtteegikdpqrvyfynqhllslknaia
agvkvkgyftwafldnfewlsgytqrfgivyvdfkdglkrypkhsalwfkkfll

SCOPe Domain Coordinates for d3wq4b_:

Click to download the PDB-style file with coordinates for d3wq4b_.
(The format of our PDB-style files is described here.)

Timeline for d3wq4b_: