SCOPe 2.08: Domain d3wnyi_: 3wny I:

Lineage for d3wnyi_ (3wny I:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein automated matches [190046] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186767] (20 PDB entries)

8. Domain d3wnyi_: 3wny I: [262440]
   automated match to d3gymi_
   complexed with so4

Details for d3wnyi_

PDB Entry: 3wny, 1.3 Å

PDB Description: A simplified BPTI variant with poly Lys amino acid tag (C3K) at the C-terminus

PDB Compounds: (I:) bovine pancreatic trypsin inhibitor

SCOPe Domain Sequences for d3wnyi_:

Sequence; same for both SEQRES and ATOM records:

>d3wnyi_ g.8.1.1 (I:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaaca

Timeline for d3wnyi_:

• d3wnyi_ first appeared in SCOPe 2.05
  
• d3wnyi_ appears in SCOPe 2.07