| Class g: Small proteins [56992] (98 folds) |
| Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) ![]() |
| Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins) |
| Protein automated matches [190046] (3 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [186767] (20 PDB entries) |
| Domain d3wnyg_: 3wny G: [262438] automated match to d3gymi_ complexed with so4 |
PDB Entry: 3wny (more details), 1.3 Å
SCOPe Domain Sequences for d3wnyg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wnyg_ g.8.1.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaacaa
Timeline for d3wnyg_: