![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
![]() | Superfamily g.8.1: BPTI-like [57362] (4 families) ![]() |
![]() | Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins) |
![]() | Protein automated matches [190046] (3 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [186767] (20 PDB entries) |
![]() | Domain d3wnyf_: 3wny F: [262437] automated match to d3gymi_ complexed with so4 |
PDB Entry: 3wny (more details), 1.3 Å
SCOPe Domain Sequences for d3wnyf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wnyf_ g.8.1.1 (F:) automated matches {Cow (Bos taurus) [TaxId: 9913]} rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaacaa
Timeline for d3wnyf_: