Lineage for d3wnyc_ (3wny C:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1962426Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 1962427Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 1962428Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 1962618Protein automated matches [190046] (3 species)
    not a true protein
  7. 1962619Species Cow (Bos taurus) [TaxId:9913] [186767] (13 PDB entries)
  8. 1962631Domain d3wnyc_: 3wny C: [262435]
    automated match to d3gymi_
    complexed with so4

Details for d3wnyc_

PDB Entry: 3wny (more details), 1.3 Å

PDB Description: A simplified BPTI variant with poly Lys amino acid tag (C3K) at the C-terminus
PDB Compounds: (C:) bovine pancreatic trypsin inhibitor

SCOPe Domain Sequences for d3wnyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wnyc_ g.8.1.1 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpafcleppyagpgkariiryfynakagaaqafvyggvrakrnnfasaadalaacaa

SCOPe Domain Coordinates for d3wnyc_:

Click to download the PDB-style file with coordinates for d3wnyc_.
(The format of our PDB-style files is described here.)

Timeline for d3wnyc_: