Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species) possibly an intermediate structure between the I set and FnIII domains |
Species Human (Homo sapiens), III [TaxId:9606] [49199] (11 PDB entries) Uniprot O75015 23-189 |
Domain d3wn5c2: 3wn5 C:84-171 [262433] Other proteins in same PDB: d3wn5a1, d3wn5a2, d3wn5b1, d3wn5b2, d3wn5d1, d3wn5d2, d3wn5e1, d3wn5e2 automated match to d1fnla2 complexed with iod, nag |
PDB Entry: 3wn5 (more details), 2.78 Å
SCOPe Domain Sequences for d3wn5c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wn5c2 b.1.1.4 (C:84-171) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} higwlllqaprwvfkeedpihlrchswkntalhkvtylqngkgrkyfhhnsdfyipkatl kdsgsyfcrglvgsknvssetvqititq
Timeline for d3wn5c2: