Lineage for d3wkrf_ (3wkr F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1867666Species Methanocaldococcus jannaschii [TaxId:243232] [258609] (2 PDB entries)
  8. 1867672Domain d3wkrf_: 3wkr F: [262428]
    automated match to d3wkrb_
    protein/RNA complex

Details for d3wkrf_

PDB Entry: 3wkr (more details), 2.8 Å

PDB Description: crystal structure of the sepcyss-sepcyse complex from methanocaldococcus jannaschii
PDB Compounds: (F:) O-phospho-L-seryl-tRNA:Cys-tRNA synthase

SCOPe Domain Sequences for d3wkrf_:

Sequence, based on SEQRES records: (download)

>d3wkrf_ c.67.1.0 (F:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
inldkyknltrsltrefinlnpiqrggilpkeakkavyeywdgysvcdychgrldevtcp
pikdflediakflnmdcarpthgaregkfivmhaickegdyvvldknahytsyvaaerak
lnvaevgyeeeyptykinlegykevidnledkgknvglillthvdgeygnlndakkvgki
akekgipfllncaytvgrmpvngkevkadfivasghksmaasapcgilafseefsdkitk
tsekfpvkeiemlgctsrglpivtlmasfphvvervkkwdeelkktryvvdelekigfkq
lgikpkehdlikfetpvldeiakkdkrrgfffydelkkrgiggiragvtkeikmsvygle
weqveyvvnaikeivesck

Sequence, based on observed residues (ATOM records): (download)

>d3wkrf_ c.67.1.0 (F:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
inldkyknltrsltrefinlnpiqrggilpkeakkavyeywdgppikdflediakflnmd
carpthgaregkfivmhaickegdyvvldknahytsyvaaeraklnvaevgyeeeyptyk
inlegykevidnledkgknvglillthvdgeygnlndakkvgkiakekgipfllncaytv
grmpvngkevkadfivasghksmaasapcgilafseefsdkitktsekfpvkeiemlgct
srglpivtlmasfphvvervkkwdeelkktryvvdelekigfkqlgikpkehdlikfetp
vldeiakkdkrrgfffydelkkrgiggiragvtkeikmsvygleweqveyvvnaikeive
sck

SCOPe Domain Coordinates for d3wkrf_:

Click to download the PDB-style file with coordinates for d3wkrf_.
(The format of our PDB-style files is described here.)

Timeline for d3wkrf_: