Lineage for d3est__ (3est -)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 465201Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)
  6. 465393Protein Elastase [50536] (4 species)
  7. 465405Species Pig (Sus scrofa) [TaxId:9823] [50538] (59 PDB entries)
  8. 465418Domain d3est__: 3est - [26242]

Details for d3est__

PDB Entry: 3est (more details), 1.65 Å

PDB Description: structure of native porcine pancreatic elastase at 1.65 angstroms resolution

SCOP Domain Sequences for d3est__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3est__ b.47.1.2 (-) Elastase {Pig (Sus scrofa)}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOP Domain Coordinates for d3est__:

Click to download the PDB-style file with coordinates for d3est__.
(The format of our PDB-style files is described here.)

Timeline for d3est__: