SCOPe 2.06: Domain d3whob_: 3who B:

Lineage for d3whob_ (3who B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.0: automated matches [258602] (1 protein)
   not a true family

6. Protein automated matches [258603] (2 species)
   not a true protein

7. Species Oyster mushroom (Pleurotus ostreatus) [TaxId:5322] [258604] (2 PDB entries)

8. Domain d3whob_: 3who B: [262410]
   automated match to d3whoa_

Details for d3whob_

PDB Entry: 3who, 1.85 Å

PDB Description: x-ray-crystallographic structure of an rnase po1 exhibiting anti-tumor activity

PDB Compounds: (B:) Guanyl-specific ribonuclease Po1

SCOPe Domain Sequences for d3whob_:

Sequence; same for both SEQRES and ATOM records:

>d3whob_ d.1.1.0 (B:) automated matches {Oyster mushroom (Pleurotus ostreatus) [TaxId: 5322]}
qtgvrscncagrsftgtdvtnairsaraggsgnyphvynnfegfsfsctptffefpvfrg
svysggspgadrviydqsgrfcaclthtgapstngfvecrf

Timeline for d3whob_:

• d3whob_ first appeared in SCOPe 2.05
  
• d3whob_ appears in SCOPe 2.07
  
• d3whob_ appears in the current release, SCOPe 2.08