SCOPe 2.07: Domain d1btua_: 1btu A:

Lineage for d1btua_ (1btu A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (123 PDB entries)

8. Domain d1btua_: 1btu A: [26241]
   complexed with 2bl, ca, so4

Details for d1btua_

PDB Entry: 1btu, 1.6 Å

PDB Description: porcine pancreatic elastase complexed with (3s, 4r)-1-toluenesulphonyl-3-ethyl-azetidin-2-one-4-carboxylic acid

PDB Compounds: (A:) elastase

SCOPe Domain Sequences for d1btua_:

Sequence; same for both SEQRES and ATOM records:

>d1btua_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d1btua_:

• d1btua_ first appeared (with stable ids) in SCOP 1.55, called d1btu__
  
• d1btua_ appears in SCOPe 2.06
  
• d1btua_ appears in the current release, SCOPe 2.08