Lineage for d1btu__ (1btu -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) 
Protein Elastase [50536] (3 species) Species Pig (Sus scrofa) [TaxId:9823] [50538] (42 PDB entries) 
Domain d1btu__: 1btu - [26241]
Details for d1btu__
PDB Entry: 1btu (more details), 1.6 Å
PDB Description: porcine pancreatic elastase complexed with (3s, 4r)-1-toluenesulphonyl-3-ethyl-azetidin-2-one-4-carboxylic acid
SCOP Domain Sequences for d1btu__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1btu__ b.47.1.2 (-) Elastase {Pig (Sus scrofa)}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
SCOP Domain Coordinates for d1btu__:
Click to download the PDB-style file with coordinates for d1btu__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1btu__:
- d1btu__ appears in SCOP 1.57
- d1btu__ appears in the current release, SCOPe 2.08, called d1btua_
View in 3D