![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Elastase [50536] (4 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [50538] (123 PDB entries) |
![]() | Domain d1btua_: 1btu A: [26241] complexed with 2bl, ca, so4 |
PDB Entry: 1btu (more details), 1.6 Å
SCOPe Domain Sequences for d1btua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1btua_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
Timeline for d1btua_: