Lineage for d3wgdi_ (3wgd I:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1854913Species Human (Homo sapiens) [TaxId:9606] [188013] (102 PDB entries)
  8. 1855132Domain d3wgdi_: 3wgd I: [262405]
    automated match to d3wgea_
    complexed with gol, k, po4

Details for d3wgdi_

PDB Entry: 3wgd (more details), 2.5 Å

PDB Description: Crystal structure of ERp46 Trx1
PDB Compounds: (I:) Thioredoxin domain-containing protein 5

SCOPe Domain Sequences for d3wgdi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wgdi_ c.47.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmskhlytadmfthgiqsaahfvmffapwcghcqrlqptwndlgdkynsmedakvyvakv
dctahsdvcsaqgvrgyptlklfkpgqeavkyqgprdfqtlenwmlqtlne

SCOPe Domain Coordinates for d3wgdi_:

Click to download the PDB-style file with coordinates for d3wgdi_.
(The format of our PDB-style files is described here.)

Timeline for d3wgdi_: