SCOPe 2.05: Domain d1elga_: 1elg A:

Lineage for d1elga_ (1elg A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (117 PDB entries)

8. Domain d1elga_: 1elg A: [26240]
   complexed with baa, ca

Details for d1elga_

PDB Entry: 1elg, 1.65 Å

PDB Description: nature of the inactivation of elastase by n-peptidyl-o-aroyl hydroxylamine as a function of ph

PDB Compounds: (A:) porcine pancreatic elastase

SCOPe Domain Sequences for d1elga_:

Sequence; same for both SEQRES and ATOM records:

>d1elga_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d1elga_:

• d1elga_ first appeared (with stable ids) in SCOP 1.55, called d1elg__
  
• d1elga_ appears in SCOPe 2.04
  
• d1elga_ appears in SCOPe 2.06
  
• d1elga_ appears in the current release, SCOPe 2.08