SCOPe 2.06: Domain d3wgdb1: 3wgd B:62-170

Lineage for d3wgdb1 (3wgd B:62-170)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (106 PDB entries)

8. Domain d3wgdb1: 3wgd B:62-170 [262398]
   Other proteins in same PDB: d3wgda2, d3wgdb2, d3wgdc2, d3wgdd2, d3wgde2, d3wgdf2, d3wgdg2, d3wgdh2, d3wgdi2
   automated match to d3wgea_
   complexed with gol, k, po4

Details for d3wgdb1

PDB Entry: 3wgd, 2.5 Å

PDB Description: Crystal structure of ERp46 Trx1

PDB Compounds: (B:) Thioredoxin domain-containing protein 5

SCOPe Domain Sequences for d3wgdb1:

Sequence; same for both SEQRES and ATOM records:

>d3wgdb1 c.47.1.0 (B:62-170) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skhlytadmfthgiqsaahfvmffapwcghcqrlqptwndlgdkynsmedakvyvakvdc
tahsdvcsaqgvrgyptlklfkpgqeavkyqgprdfqtlenwmlqtlne

Timeline for d3wgdb1:

• d3wgdb1 first appeared in SCOPe 2.05, called d3wgdb_
  
• d3wgdb1 appears in SCOPe 2.07
  
• d3wgdb1 appears in the current release, SCOPe 2.08