SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3wgdb1 (3wgd B:62-170)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (157 species)
    not a true protein
  7. 2119464Species Human (Homo sapiens) [TaxId:9606] [188013] (104 PDB entries)
  8. 2119686Domain d3wgdb1: 3wgd B:62-170 [262398]
    Other proteins in same PDB: d3wgda2, d3wgdb2, d3wgdc2, d3wgdd2, d3wgde2, d3wgdf2, d3wgdg2, d3wgdh2, d3wgdi2
    automated match to d3wgea_
    complexed with gol, k, po4

Details for d3wgdb1

PDB Entry: 3wgd (more details), 2.5 Å

PDB Description: Crystal structure of ERp46 Trx1
PDB Compounds: (B:) Thioredoxin domain-containing protein 5

SCOPe Domain Sequences for d3wgdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wgdb1 c.47.1.0 (B:62-170) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skhlytadmfthgiqsaahfvmffapwcghcqrlqptwndlgdkynsmedakvyvakvdc
tahsdvcsaqgvrgyptlklfkpgqeavkyqgprdfqtlenwmlqtlne

SCOPe Domain Coordinates for d3wgdb1:

Click to download the PDB-style file with coordinates for d3wgdb1.
(The format of our PDB-style files is described here.)

Timeline for d3wgdb1:

  • d3wgdb1 first appeared in SCOPe 2.05, called d3wgdb_