Lineage for d3wdsb_ (3wds B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830576Species Agrobacterium tumefaciens [TaxId:358] [193697] (3 PDB entries)
  8. 1830582Domain d3wdsb_: 3wds B: [262392]
    automated match to d4nbub_
    complexed with acy, edo, nad

Details for d3wdsb_

PDB Entry: 3wds (more details), 1.72 Å

PDB Description: crystal structure of 3-quinuclidinone reductase from agrobacterium tumefaciens
PDB Compounds: (B:) NADH-dependent quinuclidinone reductase

SCOPe Domain Sequences for d3wdsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wdsb_ c.2.1.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
ifdlsgrkaivtggskgigaaiaraldkagatvaiadldvmaaqavvaglenggfavevd
vtkrasvdaamqkaidalggfdllcanagvstmrpavditdeewdfnfdvnargvflanq
iacrhflasntkgvivntaslaakvgapllahysaskfavfgwtqalaremapknirvnc
vcpgfvktamqereiiweaelrgmtpeavraeyvsltplgrieepedvadvvvflasdaa
rfmtgqginvtggvrmd

SCOPe Domain Coordinates for d3wdsb_:

Click to download the PDB-style file with coordinates for d3wdsb_.
(The format of our PDB-style files is described here.)

Timeline for d3wdsb_: