SCOPe 2.08: Domain d3wd6a2: 3wd6 A:109-250

Lineage for d3wd6a2 (3wd6 A:109-250)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Silkworm (Bombyx mori) [TaxId:7091] [226184] (9 PDB entries)

8. Domain d3wd6a2: 3wd6 A:109-250 [262391]
   Other proteins in same PDB: d3wd6a1, d3wd6b1, d3wd6c1, d3wd6d1
   automated match to d3wd6b2
   complexed with edo, gsh, iod, k, peg

Details for d3wd6a2

PDB Entry: 3wd6, 2.5 Å

PDB Description: Crystal structure of Bombyx mori omega-class glutathione transferase in complex with GSH

PDB Compounds: (A:) Omega-class glutathione S-transferase

SCOPe Domain Sequences for d3wd6a2:

Sequence; same for both SEQRES and ATOM records:

>d3wd6a2 a.45.1.0 (A:109-250) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
lpqdplkkaldkiiveasapiqslfikilkfsdtvneehvaayhkaldfiqeqlknrgtv
fldgsepgyadymiwpwferlrafahdervrlepskysllleyidnmlkdsavsqylipl
eilakfheaytkkerpnyelln

Timeline for d3wd6a2:

• d3wd6a2 first appeared in SCOPe 2.05
  
• d3wd6a2 appears in SCOPe 2.07