Lineage for d1hv7a_ (1hv7 A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) 
Protein Elastase [50536] (3 species) Species Pig (Sus scrofa) [TaxId:9823] [50538] (42 PDB entries) 
Domain d1hv7a_: 1hv7 A: [26239]
Details for d1hv7a_
PDB Entry: 1hv7 (more details), 1.7 Å
PDB Description: porcine pancreatic elastase complexed with gw311616a
SCOP Domain Sequences for d1hv7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hv7a_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa)}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
SCOP Domain Coordinates for d1hv7a_:
Click to download the PDB-style file with coordinates for d1hv7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hv7a_:
- d1hv7a_ appears in SCOP 1.57
- d1hv7a_ appears in the current release, SCOPe 2.08
View in 3D