![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
![]() | Protein automated matches [190590] (26 species) not a true protein |
![]() | Species Lamellibrachia satsuma [TaxId:104711] [256471] (4 PDB entries) |
![]() | Domain d3wcva_: 3wcv A: [262388] automated match to d3wcta_ complexed with ca, hem, oxy |
PDB Entry: 3wcv (more details), 2.6 Å
SCOPe Domain Sequences for d3wcva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wcva_ a.1.1.0 (A:) automated matches {Lamellibrachia satsuma [TaxId: 104711]} dcnilqrlkvkmqwakaygfgterakfgnslwtsifnyapdardlfksvksedmrspqfk ahiarviggldrvismfdnedalnadlehlksqhdprgldalnfvvfgkalfatvggqfg vcfdlpawescykviamgitgndmfs
Timeline for d3wcva_: