SCOPe 2.08: Domain d3wchf_: 3wch F:

Lineage for d3wchf_ (3wch F:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.2: Squalene synthase [48580] (2 proteins)
   automatically mapped to Pfam PF00494

6. Protein automated matches [191305] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [190011] (24 PDB entries)

8. Domain d3wchf_: 3wch F: [262387]
   automated match to d3vjbc_
   complexed with 8ph

Details for d3wchf_

PDB Entry: 3wch, 2.5 Å

PDB Description: The complex structure of HsSQS wtih ligand BPH1237

PDB Compounds: (F:) Squalene synthase

SCOPe Domain Sequences for d3wchf_:

Sequence; same for both SEQRES and ATOM records:

>d3wchf_ a.128.1.2 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lssslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkvp
llhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigma
efldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqktn
iirdyledqqggrefwpqevwsryvkklgdfalpenidlavqclnelitnalhhipdvit
ylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavlirlgqavtlmmdatnmpavk
aiiyqymeeiyhripdsnpsssktrqiistirtq

Timeline for d3wchf_:

• d3wchf_ first appeared in SCOPe 2.05
  
• d3wchf_ appears in SCOPe 2.07