Lineage for d1b0fa_ (1b0f A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15030Protein Elastase [50536] (3 species)
  7. 15031Species Human (Homo sapiens) [TaxId:9606] [50537] (4 PDB entries)
  8. 15035Domain d1b0fa_: 1b0f A: [26237]

Details for d1b0fa_

PDB Entry: 1b0f (more details), 3 Å

PDB Description: crystal structure of human neutrophil elastase with mdl 101, 146

SCOP Domain Sequences for d1b0fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0fa_ b.47.1.2 (A:) Elastase {Human (Homo sapiens)}
ivggrrarphawpfmvslqlagghfcgatliapnfvmsaahcvanvnvravrvvlgahnl
srreptrqvfavqrifedgydpvnllndivilqlngsatinanvqvaqlpaqgrrlgngv
qclamgwgllgrnrgiasvlqelnvtvvtslcrrsnvctlvrgrqagvcfgdsgsplvcn
glihgiasfvrggcasglypdafapvaqfvnwidsiiq

SCOP Domain Coordinates for d1b0fa_:

Click to download the PDB-style file with coordinates for d1b0fa_.
(The format of our PDB-style files is described here.)

Timeline for d1b0fa_: