![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Elastase [50536] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50537] (15 PDB entries) |
![]() | Domain d1b0fa_: 1b0f A: [26237] complexed with sei |
PDB Entry: 1b0f (more details), 3 Å
SCOPe Domain Sequences for d1b0fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b0fa_ b.47.1.2 (A:) Elastase {Human (Homo sapiens) [TaxId: 9606]} ivggrrarphawpfmvslqlagghfcgatliapnfvmsaahcvanvnvravrvvlgahnl srreptrqvfavqrifedgydpvnllndivilqlngsatinanvqvaqlpaqgrrlgngv qclamgwgllgrnrgiasvlqelnvtvvtslcrrsnvctlvrgrqagvcfgdsgsplvcn glihgiasfvrggcasglypdafapvaqfvnwidsiiq
Timeline for d1b0fa_: