Lineage for d1b0fa_ (1b0f A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795358Protein Elastase [50536] (4 species)
  7. 2795361Species Human (Homo sapiens) [TaxId:9606] [50537] (15 PDB entries)
  8. 2795384Domain d1b0fa_: 1b0f A: [26237]
    complexed with sei

Details for d1b0fa_

PDB Entry: 1b0f (more details), 3 Å

PDB Description: crystal structure of human neutrophil elastase with mdl 101, 146
PDB Compounds: (A:) protein (elastase)

SCOPe Domain Sequences for d1b0fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0fa_ b.47.1.2 (A:) Elastase {Human (Homo sapiens) [TaxId: 9606]}
ivggrrarphawpfmvslqlagghfcgatliapnfvmsaahcvanvnvravrvvlgahnl
srreptrqvfavqrifedgydpvnllndivilqlngsatinanvqvaqlpaqgrrlgngv
qclamgwgllgrnrgiasvlqelnvtvvtslcrrsnvctlvrgrqagvcfgdsgsplvcn
glihgiasfvrggcasglypdafapvaqfvnwidsiiq

SCOPe Domain Coordinates for d1b0fa_:

Click to download the PDB-style file with coordinates for d1b0fa_.
(The format of our PDB-style files is described here.)

Timeline for d1b0fa_: