![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
![]() | Protein automated matches [190052] (5 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [232271] (5 PDB entries) |
![]() | Domain d3wa0f3: 3wa0 F:215-311 [262368] Other proteins in same PDB: d3wa0a1, d3wa0a2, d3wa0b1, d3wa0b2, d3wa0c1, d3wa0c2, d3wa0d1, d3wa0d2, d3wa0e1, d3wa0e2, d3wa0f1, d3wa0f2 automated match to d1h4ra2 |
PDB Entry: 3wa0 (more details), 2.31 Å
SCOPe Domain Sequences for d3wa0f3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wa0f3 b.55.1.0 (F:215-311) automated matches {Mouse (Mus musculus) [TaxId: 10090]} emygvnyftirnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik pldkkidvfkfnssklrvnklilqlcignhdlfmrrr
Timeline for d3wa0f3: