Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (8 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [232271] (6 PDB entries) |
Domain d3wa0d3: 3wa0 D:215-313 [262362] Other proteins in same PDB: d3wa0a1, d3wa0a2, d3wa0b1, d3wa0b2, d3wa0c1, d3wa0c2, d3wa0d1, d3wa0d2, d3wa0e1, d3wa0e2, d3wa0f1, d3wa0f2 automated match to d1h4ra2 |
PDB Entry: 3wa0 (more details), 2.31 Å
SCOPe Domain Sequences for d3wa0d3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wa0d3 b.55.1.0 (D:215-313) automated matches {Mouse (Mus musculus) [TaxId: 10090]} emygvnyftirnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik pldkkidvfkfnssklrvnklilqlcignhdlfmrrrka
Timeline for d3wa0d3: