Lineage for d3wa0c3 (3wa0 C:215-313)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803713Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2803714Protein automated matches [190052] (8 species)
    not a true protein
  7. 2803943Species Mouse (Mus musculus) [TaxId:10090] [232271] (6 PDB entries)
  8. 2803949Domain d3wa0c3: 3wa0 C:215-313 [262359]
    Other proteins in same PDB: d3wa0a1, d3wa0a2, d3wa0b1, d3wa0b2, d3wa0c1, d3wa0c2, d3wa0d1, d3wa0d2, d3wa0e1, d3wa0e2, d3wa0f1, d3wa0f2
    automated match to d1h4ra2

Details for d3wa0c3

PDB Entry: 3wa0 (more details), 2.31 Å

PDB Description: crystal structure of merlin complexed with dcaf1/vprbp
PDB Compounds: (C:) merlin

SCOPe Domain Sequences for d3wa0c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wa0c3 b.55.1.0 (C:215-313) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
emygvnyftirnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik
pldkkidvfkfnssklrvnklilqlcignhdlfmrrrka

SCOPe Domain Coordinates for d3wa0c3:

Click to download the PDB-style file with coordinates for d3wa0c3.
(The format of our PDB-style files is described here.)

Timeline for d3wa0c3: