![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.11.2: Second domain of FERM [47031] (2 families) ![]() automatically mapped to Pfam PF00373 |
![]() | Family a.11.2.0: automated matches [254193] (1 protein) not a true family |
![]() | Protein automated matches [254423] (5 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [255101] (5 PDB entries) |
![]() | Domain d3wa0c2: 3wa0 C:104-214 [262358] Other proteins in same PDB: d3wa0a1, d3wa0a3, d3wa0b1, d3wa0b3, d3wa0c1, d3wa0c3, d3wa0d1, d3wa0d3, d3wa0e1, d3wa0e3, d3wa0f1, d3wa0f3 automated match to d1h4ra1 |
PDB Entry: 3wa0 (more details), 2.31 Å
SCOPe Domain Sequences for d3wa0c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wa0c2 a.11.2.0 (C:104-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]} naeeelvqeitqhlfflqvkkqildekvycppeasvllasyavqakygdydpsvhkrgfl aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl
Timeline for d3wa0c2: