| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
| Protein automated matches [190233] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [189205] (17 PDB entries) |
| Domain d3wa0c1: 3wa0 C:21-103 [262357] Other proteins in same PDB: d3wa0a2, d3wa0a3, d3wa0b2, d3wa0b3, d3wa0c2, d3wa0c3, d3wa0d2, d3wa0d3, d3wa0e2, d3wa0e3, d3wa0f2, d3wa0f3 automated match to d1h4ra3 |
PDB Entry: 3wa0 (more details), 2.31 Å
SCOPe Domain Sequences for d3wa0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wa0c1 d.15.1.0 (C:21-103) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmdkk
vldhdvskeepvtfhflakfype
Timeline for d3wa0c1: