Lineage for d3wa0b1 (3wa0 B:23-103)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540532Species Mouse (Mus musculus) [TaxId:10090] [189205] (16 PDB entries)
  8. 2540557Domain d3wa0b1: 3wa0 B:23-103 [262354]
    Other proteins in same PDB: d3wa0a2, d3wa0a3, d3wa0b2, d3wa0b3, d3wa0c2, d3wa0c3, d3wa0d2, d3wa0d3, d3wa0e2, d3wa0e3, d3wa0f2, d3wa0f3
    automated match to d1h4ra3

Details for d3wa0b1

PDB Entry: 3wa0 (more details), 2.31 Å

PDB Description: crystal structure of merlin complexed with dcaf1/vprbp
PDB Compounds: (B:) merlin

SCOPe Domain Sequences for d3wa0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wa0b1 d.15.1.0 (B:23-103) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmdkkvl
dhdvskeepvtfhflakfype

SCOPe Domain Coordinates for d3wa0b1:

Click to download the PDB-style file with coordinates for d3wa0b1.
(The format of our PDB-style files is described here.)

Timeline for d3wa0b1: