Lineage for d3vbsb_ (3vbs B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822534Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2822535Protein automated matches [190988] (51 species)
    not a true protein
  7. 2822651Species Human enterovirus 71 [TaxId:39054] [226325] (11 PDB entries)
  8. 2822661Domain d3vbsb_: 3vbs B: [262352]
    automated match to d4rqpc_
    complexed with sph

Details for d3vbsb_

PDB Entry: 3vbs (more details), 3 Å

PDB Description: Crystal structure of human Enterovirus 71
PDB Compounds: (B:) Genome Polyprotein, capsid protein VP2

SCOPe Domain Sequences for d3vbsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vbsb_ b.121.4.0 (B:) automated matches {Human enterovirus 71 [TaxId: 39054]}
sdrvaqltignstittqeaaniivgygewpsycsdsdatavdkptrpdvsvnrfytldtk
lweksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvqcnaskfhqgallvavlpe
yvigtvaggtgtedthppykqtqpgadgfelqhpyvldagipisqltvcphqwinlrtnn
catiivpyinalpfdsalnhcnfgllvvpispldydqgatpvipititlapmcsefaglr
qavtq

SCOPe Domain Coordinates for d3vbsb_:

Click to download the PDB-style file with coordinates for d3vbsb_.
(The format of our PDB-style files is described here.)

Timeline for d3vbsb_: