Lineage for d1hnee_ (1hne E:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1127559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1127765Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1128102Protein Elastase [50536] (4 species)
  7. 1128105Species Human (Homo sapiens) [TaxId:9606] [50537] (5 PDB entries)
  8. 1128107Domain d1hnee_: 1hne E: [26235]

Details for d1hnee_

PDB Entry: 1hne (more details), 1.84 Å

PDB Description: Structure of human neutrophil elastase in complex with a peptide chloromethyl ketone inhibitor at 1.84-angstroms resolution
PDB Compounds: (E:) human leucocyte elastase

SCOPe Domain Sequences for d1hnee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnee_ b.47.1.2 (E:) Elastase {Human (Homo sapiens) [TaxId: 9606]}
ivggrrarphawpfmvslqlrgghfcgatliapnfvmsaahcvanvnvravrvvlgahnl
srreptrqvfavqrifedgydpvnllndivilqlngsatinanvqvaqlpaqgrrlgngv
qclamgwgllgrnrgiasvlqelnvtvvtslcrrsnvctlvrgrqagvcfgdsgsplvcn
glihgiasfvrggcasglypdafapvaqfvnwidsiiq

SCOPe Domain Coordinates for d1hnee_:

Click to download the PDB-style file with coordinates for d1hnee_.
(The format of our PDB-style files is described here.)

Timeline for d1hnee_: