SCOP 1.75: Domain d1hnee_: 1hne E:

Lineage for d1hnee_ (1hne E:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50537] (7 PDB entries)

8. Domain d1hnee_: 1hne E: [26235]
   complexed with msu

Details for d1hnee_

PDB Entry: 1hne, 1.84 Å

PDB Description: Structure of human neutrophil elastase in complex with a peptide chloromethyl ketone inhibitor at 1.84-angstroms resolution

PDB Compounds: (E:) human leucocyte elastase

SCOP Domain Sequences for d1hnee_:

Sequence; same for both SEQRES and ATOM records:

>d1hnee_ b.47.1.2 (E:) Elastase {Human (Homo sapiens) [TaxId: 9606]}
ivggrrarphawpfmvslqlrgghfcgatliapnfvmsaahcvanvnvravrvvlgahnl
srreptrqvfavqrifedgydpvnllndivilqlngsatinanvqvaqlpaqgrrlgngv
qclamgwgllgrnrgiasvlqelnvtvvtslcrrsnvctlvrgrqagvcfgdsgsplvcn
glihgiasfvrggcasglypdafapvaqfvnwidsiiq

Timeline for d1hnee_:

• d1hnee_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnee_ appears in SCOP 1.73
  
• d1hnee_ appears in SCOPe 2.01
  
• d1hnee_ appears in the current release, SCOPe 2.08