SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3uaoe_ (3uao E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108002Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2108003Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2108056Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2108057Protein automated matches [190499] (20 species)
    not a true protein
  7. 2108071Species Bordetella bronchiseptica [TaxId:518] [256004] (2 PDB entries)
  8. 2108076Domain d3uaoe_: 3uao E: [262348]
    automated match to d3uaod_
    complexed with act

Details for d3uaoe_

PDB Entry: 3uao (more details), 2.4 Å

PDB Description: Structure and Catalytic Mechanism of the Vitamin B3 Degradative Enzyme Maleamate Amidohydrolase from Bordetalla bronchiseptica RB50
PDB Compounds: (E:) Putative isochorismatase

SCOPe Domain Sequences for d3uaoe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uaoe_ c.33.1.0 (E:) automated matches {Bordetella bronchiseptica [TaxId: 518]}
lgsyerqgfgaalplkapygllivdfvngfadpaqfgggniaaaiettrtvlaaarergw
avahsrivyadddadgnifsikvpgmltlkehapasaivpqlapqageyvvrkstpsafy
gtmlaawlaqrgvqtllvagattsgcvrasvvdamsagfrplvlsdcvgdralgpheanl
fdmrqkyaavmthdealaktk

SCOPe Domain Coordinates for d3uaoe_:

Click to download the PDB-style file with coordinates for d3uaoe_.
(The format of our PDB-style files is described here.)

Timeline for d3uaoe_: