Lineage for d3uaob_ (3uao B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445599Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445600Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2445653Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2445654Protein automated matches [190499] (24 species)
    not a true protein
  7. 2445668Species Bordetella bronchiseptica [TaxId:518] [256004] (2 PDB entries)
  8. 2445670Domain d3uaob_: 3uao B: [262346]
    automated match to d3uaod_
    complexed with act

Details for d3uaob_

PDB Entry: 3uao (more details), 2.4 Å

PDB Description: Structure and Catalytic Mechanism of the Vitamin B3 Degradative Enzyme Maleamate Amidohydrolase from Bordetalla bronchiseptica RB50
PDB Compounds: (B:) Putative isochorismatase

SCOPe Domain Sequences for d3uaob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uaob_ c.33.1.0 (B:) automated matches {Bordetella bronchiseptica [TaxId: 518]}
lgsyerqgfgaalplkapygllivdfvngfadpaqfgggniaaaiettrtvlaaarergw
avahsrivyadddadgnifsikvpgmltlkehapasaivpqlapqageyvvrkstpsafy
gtmlaawlaqrgvqtllvagattsgcvrasvvdamsagfrplvlsdcvgdralgpheanl
fdmrqkyaavmthdealakt

SCOPe Domain Coordinates for d3uaob_:

Click to download the PDB-style file with coordinates for d3uaob_.
(The format of our PDB-style files is described here.)

Timeline for d3uaob_: