Lineage for d3u1hb_ (3u1h B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138634Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 protein domains)
    the active site is between the two identical subunits
  6. 2138635Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (11 species)
  7. 2138641Species Bacillus sp. [TaxId:1409] [254872] (1 PDB entry)
  8. 2138643Domain d3u1hb_: 3u1h B: [262344]
    automated match to d3u1ha_

Details for d3u1hb_

PDB Entry: 3u1h (more details), 2.8 Å

PDB Description: Crystal structure of IPMDH from the last common ancestor of Bacillus
PDB Compounds: (B:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d3u1hb_:

Sequence, based on SEQRES records: (download)

>d3u1hb_ c.77.1.1 (B:) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus sp. [TaxId: 1409]}
kkkiavlpgdgigpevmeaaievlkavaerfghefefeygliggaaideagtplpeetld
vcrgsdaillgavggpkwdqnpselrpekgllgirkgldlfanlrpvkvydsladasplk
keviegvdlvivreltgglyfgepseryeegeeaavdtllytreeieriirkafelaltr
kkkvtsvdkanvlessrlwrevaeevakeypdvelehmlvdnaamqlirnprqfdvivte
nmfgdilsdeasmitgslgmlpsaslstdglglyepvhgsapdiagkgianplatilsaa
mmlrysfgleeeakaiekavekvlaegyrtadiakpggkyvsttemtdevkaavvdelat
saimt

Sequence, based on observed residues (ATOM records): (download)

>d3u1hb_ c.77.1.1 (B:) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus sp. [TaxId: 1409]}
kkkiavlpgdgigpevmeaaievlkavaerfghefefeygliggaaideagtplpeetld
vcrgsdaillgavggpkwdqnpselrpekgllgirkgldlfanlrpvkvydsladasplk
keviegvdlvivreltgglyeegeeaavdtllytreeieriirkafelaltrkkkvtsvd
kanvlessrlwrevaeevakeypdvelehmlvdnaamqlirnprqfdvivtenmfgdils
deasmitgslgmlpsaslstdglglyepvhgsapdiagkgianplatilsaammlrysfg
leeeakaiekavekvlaegyrtadiakpggkyvsttemtdevkaavvdelatsaimt

SCOPe Domain Coordinates for d3u1hb_:

Click to download the PDB-style file with coordinates for d3u1hb_.
(The format of our PDB-style files is described here.)

Timeline for d3u1hb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3u1ha_