Lineage for d3qd8p1 (3qd8 P:10-163)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704407Species Mycobacterium tuberculosis [TaxId:419947] [255998] (2 PDB entries)
  8. 2704446Domain d3qd8p1: 3qd8 P:10-163 [262330]
    automated match to d3oj5a_

Details for d3qd8p1

PDB Entry: 3qd8 (more details), 3 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis BfrB
PDB Compounds: (P:) Probable bacterioferritin BfrB

SCOPe Domain Sequences for d3qd8p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qd8p1 a.25.1.0 (P:10-163) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
qeqieevalmatlvrvadraganlfelenfvare

SCOPe Domain Coordinates for d3qd8p1:

Click to download the PDB-style file with coordinates for d3qd8p1.
(The format of our PDB-style files is described here.)

Timeline for d3qd8p1: