SCOPe 2.05: Domain d1pytc_: 1pyt C:

Lineage for d1pytc_ (1pyt C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Procarboxypeptidase A-S6 subunit III (zymogen E) [50534] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50535] (2 PDB entries)

8. Domain d1pytc_: 1pyt C: [26233]
   Other proteins in same PDB: d1pyta_, d1pytb_, d1pytd_
   complexed with ca, zn

Details for d1pytc_

PDB Entry: 1pyt, 2.35 Å

PDB Description: ternary complex of procarboxypeptidase a, proproteinase e, and chymotrypsinogen c

PDB Compounds: (C:) proproteinase e

SCOPe Domain Sequences for d1pytc_:

Sequence; same for both SEQRES and ATOM records:

>d1pytc_ b.47.1.2 (C:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]}
srpssrvvngedavpyswswqvslqyekdgafhhtcggsliapdwvvtaghcistsrtyq
vvlgeydrsvlqgseqvipinagdlfvhplwnsncvacgndialvklsrsaqlgdkvqla
nlppagdilpneapcyisgwgrlytggplpdklqeallpvvdyehcsqydwwgitvkktm
vcaggdtrsgcdgdsggplncpaadgswqvhgvtsfvsafgcntikkptvftrvsafidw
inetiasn

Timeline for d1pytc_:

• d1pytc_ first appeared (with stable ids) in SCOP 1.55
  
• d1pytc_ appears in SCOPe 2.04
  
• d1pytc_ appears in SCOPe 2.06
  
• d1pytc_ appears in the current release, SCOPe 2.08