Lineage for d1pytc_ (1pyt C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1546190Protein Procarboxypeptidase A-S6 subunit III (zymogen E) [50534] (1 species)
  7. 1546191Species Cow (Bos taurus) [TaxId:9913] [50535] (2 PDB entries)
  8. 1546194Domain d1pytc_: 1pyt C: [26233]
    Other proteins in same PDB: d1pyta_, d1pytb_, d1pytd_
    complexed with ca, zn

Details for d1pytc_

PDB Entry: 1pyt (more details), 2.35 Å

PDB Description: ternary complex of procarboxypeptidase a, proproteinase e, and chymotrypsinogen c
PDB Compounds: (C:) proproteinase e

SCOPe Domain Sequences for d1pytc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pytc_ b.47.1.2 (C:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]}
srpssrvvngedavpyswswqvslqyekdgafhhtcggsliapdwvvtaghcistsrtyq
vvlgeydrsvlqgseqvipinagdlfvhplwnsncvacgndialvklsrsaqlgdkvqla
nlppagdilpneapcyisgwgrlytggplpdklqeallpvvdyehcsqydwwgitvkktm
vcaggdtrsgcdgdsggplncpaadgswqvhgvtsfvsafgcntikkptvftrvsafidw
inetiasn

SCOPe Domain Coordinates for d1pytc_:

Click to download the PDB-style file with coordinates for d1pytc_.
(The format of our PDB-style files is described here.)

Timeline for d1pytc_: