Lineage for d1pytc_ (1pyt C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15159Protein Procarboxypeptidase A-S6 subunit III (zymogen E) [50534] (1 species)
  7. 15160Species Cow (Bos taurus) [TaxId:9913] [50535] (2 PDB entries)
  8. 15163Domain d1pytc_: 1pyt C: [26233]
    Other proteins in same PDB: d1pyta_, d1pytb_, d1pytd_

Details for d1pytc_

PDB Entry: 1pyt (more details), 2.35 Å

PDB Description: ternary complex of procarboxypeptidase a, proproteinase e, and chymotrypsinogen c

SCOP Domain Sequences for d1pytc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pytc_ b.47.1.2 (C:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus)}
srpssrvvngedavpyswswqvslqyekdgafhhtcggsliapdwvvtaghcistsrtyq
vvlgeydrsvlqgseqvipinagdlfvhplwnsncvacgndialvklsrsaqlgdkvqla
nlppagdilpneapcyisgwgrlytggplpdklqeallpvvdyehcsqydwwgitvkktm
vcaggdtrsgcdgdsggplncpaadgswqvhgvtsfvsafgcntikkptvftrvsafidw
inetiasn

SCOP Domain Coordinates for d1pytc_:

Click to download the PDB-style file with coordinates for d1pytc_.
(The format of our PDB-style files is described here.)

Timeline for d1pytc_: