| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:419947] [255998] (2 PDB entries) |
| Domain d3qd8h1: 3qd8 H:10-163 [262322] automated match to d3oj5a_ |
PDB Entry: 3qd8 (more details), 3 Å
SCOPe Domain Sequences for d3qd8h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qd8h1 a.25.1.0 (H:10-163) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
qeqieevalmatlvrvadraganlfelenfvare
Timeline for d3qd8h1: