Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Procarboxypeptidase A-S6 subunit III (zymogen E) [50534] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [50535] (2 PDB entries) |
Domain d1fonb_: 1fon B: [26232] |
PDB Entry: 1fon (more details), 1.7 Å
SCOPe Domain Sequences for d1fonb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fonb_ b.47.1.2 (B:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} swswqvslqyekdgafhhtcggsliapdwvvtaghcistsrtyqvvlgeydrsvlegseq vipinagdlfvhplwnsncvacgndialvklsrsaqlgdkvqlanlppagdilpneapcy isgwgrlytggplpdklqqallptvdyehcsqwdwwgitvkktmvcaggdtrsgcngdsg gplncpaadgswqvhgvtsfvsafgcntikkptvftrvsafidwidetiasn
Timeline for d1fonb_: